![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (8 proteins) |
![]() | Protein CD4 C2-set domains [49149] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49150] (32 PDB entries) |
![]() | Domain d1wipb4: 1wip B:292-363 [21674] Other proteins in same PDB: d1wipa1, d1wipa2, d1wipb1, d1wipb2 domains 2 and 4 |
PDB Entry: 1wip (more details), 4 Å
SCOPe Domain Sequences for d1wipb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wipb4 b.1.1.3 (B:292-363) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} mratqlqknltcevwgptspklmlslklenkeakvskrekavwvlnpeagmwqcllsdsg qvllesnikvlp
Timeline for d1wipb4:
![]() Domains from other chains: (mouse over for more information) d1wipa1, d1wipa2, d1wipa3, d1wipa4 |