Lineage for d3tclb1 (3tcl B:1-107)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2355728Domain d3tclb1: 3tcl B:1-107 [216736]
    Other proteins in same PDB: d3tclb2, d3tcll2
    automated match to d1rhha1
    complexed with imd

Details for d3tclb1

PDB Entry: 3tcl (more details), 1.91 Å

PDB Description: Crystal Structure of HIV-1 Neutralizing Antibody CH04
PDB Compounds: (B:) CH04 Light Chain Fab

SCOPe Domain Sequences for d3tclb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tclb1 b.1.1.0 (B:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspdtlslspgeratlscrasqsvhsryfawyqhkpgqpprlliyggstratgip
nrfsaggsgtqftltvnrleaedfavyycqqygrspytfgqgtkveir

SCOPe Domain Coordinates for d3tclb1:

Click to download the PDB-style file with coordinates for d3tclb1.
(The format of our PDB-style files is described here.)

Timeline for d3tclb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tclb2