Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.3: C2 set domains [49142] (8 proteins) |
Protein CD4 C2-set domains [49149] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49150] (31 PDB entries) |
Domain d1wipb3: 1wip B:98-178 [21673] Other proteins in same PDB: d1wipa1, d1wipa2, d1wipb1, d1wipb2 domains 2 and 4 |
PDB Entry: 1wip (more details), 4 Å
SCOPe Domain Sequences for d1wipb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wipb3 b.1.1.3 (B:98-178) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw tctvlqnqkkvefkidivvla
Timeline for d1wipb3:
View in 3D Domains from other chains: (mouse over for more information) d1wipa1, d1wipa2, d1wipa3, d1wipa4 |