Lineage for d1wipb3 (1wip B:98-178)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 656760Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 656770Protein CD4 C2-set domains [49149] (2 species)
  7. 656771Species Human (Homo sapiens) [TaxId:9606] [49150] (25 PDB entries)
  8. 656800Domain d1wipb3: 1wip B:98-178 [21673]
    Other proteins in same PDB: d1wipa1, d1wipa2, d1wipb1, d1wipb2

Details for d1wipb3

PDB Entry: 1wip (more details), 4 Å

PDB Description: structure of t-cell surface glycoprotein cd4, monoclinic crystal form
PDB Compounds: (B:) T-cell surface glycoprotein cd4

SCOP Domain Sequences for d1wipb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wipb3 b.1.1.3 (B:98-178) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

SCOP Domain Coordinates for d1wipb3:

Click to download the PDB-style file with coordinates for d1wipb3.
(The format of our PDB-style files is described here.)

Timeline for d1wipb3: