Lineage for d3tblc2 (3tbl C:127-258)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1927131Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1927132Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 1927317Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 1927339Protein Proliferating cell nuclear antigen (PCNA) [55989] (7 species)
  7. 1927375Species Human (Homo sapiens) [TaxId:9606] [55991] (9 PDB entries)
    Uniprot P12004
  8. 1927415Domain d3tblc2: 3tbl C:127-258 [216727]
    Other proteins in same PDB: d3tbld_, d3tble_
    automated match to d1u7ba2

Details for d3tblc2

PDB Entry: 3tbl (more details), 2.9 Å

PDB Description: structure of mono-ubiquitinated pcna: implications for dna polymerase switching and okazaki fragment maturation
PDB Compounds: (C:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d3tblc2:

Sequence, based on SEQRES records: (download)

>d3tblc2 d.131.1.2 (C:127-258) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
nvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh
lkyylapkiede

Sequence, based on observed residues (ATOM records): (download)

>d3tblc2 d.131.1.2 (C:127-258) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqte
eavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmghlkyyla
pkiede

SCOPe Domain Coordinates for d3tblc2:

Click to download the PDB-style file with coordinates for d3tblc2.
(The format of our PDB-style files is described here.)

Timeline for d3tblc2: