Lineage for d3tbfh_ (3tbf H:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140245Family c.80.1.1: double-SIS domain [53698] (5 protein domains)
    duplication: consists of two SIS domains related by pseudo dyad
  6. 2140277Protein automated matches [227069] (2 species)
    not a true protein
  7. 2140293Species Francisella tularensis [TaxId:119856] [226197] (1 PDB entry)
  8. 2140301Domain d3tbfh_: 3tbf H: [216721]
    automated match to d1mosa_

Details for d3tbfh_

PDB Entry: 3tbf (more details), 2.28 Å

PDB Description: c-terminal domain of glucosamine-fructose-6-phosphate aminotransferase from francisella tularensis.
PDB Compounds: (H:) glucosamine--fructose-6-phosphate aminotransferase [isomerizing]

SCOPe Domain Sequences for d3tbfh_:

Sequence, based on SEQRES records: (download)

>d3tbfh_ c.80.1.1 (H:) automated matches {Francisella tularensis [TaxId: 119856]}
saskdgykhymlkeiyeqpeavsntilasladgeisldsfdkrakelfektkhicivacg
tsynagmtakywiekyakvpcsveiaseiryrdnvvvdgslfvsisqsgetadtleslrk
skkqnyvgsmcicnvpnsslvresdiafmtkagveigvastkafttqlvalaiftlviak
lknsltdqqiakyteelkniralvmgalkldteidqiseyfsdkehtiflgrglyypiai
egalklkeisyihaeaypsgelkhgplalvdknmpivavvpndelldktlsnlqevharg
gklilfvdkavkervnfdnsivleldaghdfsapvvftiplqllsyhvaiikgtdvdqp

Sequence, based on observed residues (ATOM records): (download)

>d3tbfh_ c.80.1.1 (H:) automated matches {Francisella tularensis [TaxId: 119856]}
saskdgykhymlkeiyeqpeavsntilasladgeislddkrakelfektkhicivacgts
ynagmtakywiekyakvpcsveiaseiryrdnvvvdgslfvsisqsgetadtleslrksk
kqnyvgsmcicnvpnsslvresdiafmtkagveigvastkafttqlvalaiftlviaklk
nsltdqqiakyteelkniralvmgalkldteidqiseyfsdkehtiflgrglyypiaieg
alklkeisyihaeaypsgelkhgplalvdknmpivavvpndelldktlsnlqevharggk
lilfvdkavkervnfdnsivleldaghdfsapvvftiplqllsyhvaiikgtdvdqp

SCOPe Domain Coordinates for d3tbfh_:

Click to download the PDB-style file with coordinates for d3tbfh_.
(The format of our PDB-style files is described here.)

Timeline for d3tbfh_: