Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) |
Family c.33.1.0: automated matches [191389] (1 protein) not a true family |
Protein automated matches [190499] (26 species) not a true protein |
Species Vibrio cholerae [TaxId:666] [226451] (2 PDB entries) |
Domain d3tb4a_: 3tb4 A: [216711] automated match to d3r77a_ complexed with bog, ca, edo, peg, pge |
PDB Entry: 3tb4 (more details), 1.35 Å
SCOPe Domain Sequences for d3tb4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tb4a_ c.33.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]} ipkiasyplpvslptnkvdwridasravllihdmqeyfvhyfdsqaepipslikhiqqlk ahakqagipvvytaqpanqdpaerallsdfwgpglseetaiiaplapesgdvqltkwrys afkksplldwlretgrdqliitgvyahigilstaldafmfdiqpfvigdgvadfslsdhe fslryisgrtgavkstqqacleiaa
Timeline for d3tb4a_: