Lineage for d1wipa3 (1wip A:98-178)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 786974Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 786984Protein CD4 C2-set domains [49149] (2 species)
  7. 786985Species Human (Homo sapiens) [TaxId:9606] [49150] (26 PDB entries)
  8. 787014Domain d1wipa3: 1wip A:98-178 [21671]
    Other proteins in same PDB: d1wipa1, d1wipa2, d1wipb1, d1wipb2
    domains 2 and 4

Details for d1wipa3

PDB Entry: 1wip (more details), 4 Å

PDB Description: structure of t-cell surface glycoprotein cd4, monoclinic crystal form
PDB Compounds: (A:) T-cell surface glycoprotein cd4

SCOP Domain Sequences for d1wipa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wipa3 b.1.1.3 (A:98-178) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

SCOP Domain Coordinates for d1wipa3:

Click to download the PDB-style file with coordinates for d1wipa3.
(The format of our PDB-style files is described here.)

Timeline for d1wipa3: