SCOPe 2.05: Domain d3ta8a_: 3ta8 A:

Lineage for d3ta8a_ (3ta8 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Dodecameric ferritin homolog [47250] (14 species)

7. Species Helicobacter pylori, Nap [TaxId:210] [81743] (7 PDB entries)

8. Domain d3ta8a_: 3ta8 A: [216709]
   automated match to d2cf7a_
   complexed with edo, fe

Details for d3ta8a_

PDB Entry: 3ta8, 2.5 Å

PDB Description: Crystal structure HP-NAP from strain YS39 iron loaded (cocrystallization 5mM)

PDB Compounds: (A:) Neutrophil-activating protein

SCOPe Domain Sequences for d3ta8a_:

Sequence; same for both SEQRES and ATOM records:

>d3ta8a_ a.25.1.1 (A:) Dodecameric ferritin homolog {Helicobacter pylori, Nap [TaxId: 210]}
mktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkateeiyegfadmfddlaeriaq
lghhplvtlsealkltrvkeetktsfhskdifkeiledykhlekefkelsntaekegdkv
tvtyaddqlaklqksiwmlqahla

Timeline for d3ta8a_:

• d3ta8a_ first appeared in SCOPe 2.03
  
• d3ta8a_ appears in SCOPe 2.04
  
• d3ta8a_ appears in SCOPe 2.06
  
• d3ta8a_ appears in the current release, SCOPe 2.08