Lineage for d3t7cc_ (3t7c C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1831639Species Mycobacterium avium [TaxId:243243] [189589] (5 PDB entries)
  8. 1831646Domain d3t7cc_: 3t7c C: [216699]
    automated match to d3uwrd_
    complexed with nad

Details for d3t7cc_

PDB Entry: 3t7c (more details), 1.95 Å

PDB Description: crystal structure of carveol dehydrogenase from mycobacterium avium bound to nad
PDB Compounds: (C:) carveol dehydrogenase

SCOPe Domain Sequences for d3t7cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t7cc_ c.2.1.0 (C:) automated matches {Mycobacterium avium [TaxId: 243243]}
magkvegkvafitgaargqgrshaitlaregadiiaidvckqldgvklpmstpddlaetv
rqvealgrriiasqvdvrdfdamqaavddgvtqlgrldivlanaalasegtrlnrmdpkt
wrdmidvnlngawitarvaiphimagkrggsivftssigglrgaenignyiaskhglhgl
mrtmalelgprnirvnivcpssvatpmllneptyrmfrpdlenptvedfqvasrqmhvlp
ipyvepadisnailflvsddaryitgvslpvdggallk

SCOPe Domain Coordinates for d3t7cc_:

Click to download the PDB-style file with coordinates for d3t7cc_.
(The format of our PDB-style files is described here.)

Timeline for d3t7cc_: