Class b: All beta proteins [48724] (180 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
Protein automated matches [190798] (9 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [188061] (4 PDB entries) |
Domain d3t64b_: 3t64 B: [216694] automated match to d2y8ca_ complexed with du3, so4 |
PDB Entry: 3t64 (more details), 1.65 Å
SCOPe Domain Sequences for d3t64b_:
Sequence, based on SEQRES records: (download)
>d3t64b_ b.85.4.1 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]} mhlkivclsdevremyknhkthhegdsgldlfivkdevlkpksttfvklgikaialqyks nyyykceksenkkkdddksnivntsfllfprssisktplrlansiglidagyrgeiiaal dntsdqeyhikkndklvqlvsftgeplsfelveel
>d3t64b_ b.85.4.1 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]} mhlkivclsdevremyknhdsgldlfivkdevlkpksttfvklgikaialqyksnyyykn ivntsfllfprssisktplrlansiglidagyrgeiiaaldntsdqeyhikkndklvqlv sftgeplsfelveel
Timeline for d3t64b_: