SCOPe 2.05: Domain d3t64a_: 3t64 A:

Lineage for d3t64a_ (3t64 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein automated matches [190798] (8 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [188061] (4 PDB entries)

8. Domain d3t64a_: 3t64 A: [216693]
   automated match to d2y8ca_
   complexed with du3, so4

Details for d3t64a_

PDB Entry: 3t64, 1.65 Å

PDB Description: 5'-diphenyl nucleoside inhibitors of plasmodium falciparum dutpase

PDB Compounds: (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase, putative

SCOPe Domain Sequences for d3t64a_:

Sequence, based on SEQRES records:

>d3t64a_ b.85.4.1 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mhlkivclsdevremyknhkthhegdsgldlfivkdevlkpksttfvklgikaialqyks
nyyykceksenkkkdddksnivntsfllfprssisktplrlansiglidagyrgeiiaal
dntsdqeyhikkndklvqlvsftgeplsfelveeldetsrgeggfgs

Sequence, based on observed residues (ATOM records):

>d3t64a_ b.85.4.1 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mhlkivclsdevremyknhkthhegdsgldlfivkdevlkpksttfvklgikaialqyks
nyyyknivntsfllfprssisktplrlansiglidagyrgeiiaaldntsdqeyhikknd
klvqlvsftgeplsfelveeldetsrgeggfgs

Timeline for d3t64a_:

• d3t64a_ first appeared in SCOPe 2.03
  
• d3t64a_ appears in SCOPe 2.04
  
• d3t64a_ appears in SCOPe 2.06
  
• d3t64a_ appears in the current release, SCOPe 2.08