Lineage for d1wiob3 (1wio B:98-178)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 935232Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 935242Protein CD4 C2-set domains [49149] (2 species)
  7. 935243Species Human (Homo sapiens) [TaxId:9606] [49150] (26 PDB entries)
  8. 935269Domain d1wiob3: 1wio B:98-178 [21669]
    Other proteins in same PDB: d1wioa1, d1wioa2, d1wiob1, d1wiob2
    domains 2 and 4

Details for d1wiob3

PDB Entry: 1wio (more details), 3.9 Å

PDB Description: structure of t-cell surface glycoprotein cd4, tetragonal crystal form
PDB Compounds: (B:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d1wiob3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wiob3 b.1.1.3 (B:98-178) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

SCOPe Domain Coordinates for d1wiob3:

Click to download the PDB-style file with coordinates for d1wiob3.
(The format of our PDB-style files is described here.)

Timeline for d1wiob3: