SCOPe 2.03: Domain d3t4ud_: 3t4u D:

Lineage for d3t4ud_ (3t4u D:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.12: Haloperoxidase [53531] (8 proteins)
   automatically mapped to Pfam PF12697
   automatically mapped to Pfam PF00561

6. Protein automated matches [190860] (3 species)
   not a true protein

7. Species Pseudomonas fluorescens [TaxId:294] [189239] (5 PDB entries)

8. Domain d3t4ud_: 3t4u D: [216683]
   automated match to d3t52b_
   complexed with cl, gol, na, so4; mutant

Details for d3t4ud_

PDB Entry: 3t4u, 2.02 Å

PDB Description: L29I Mutation in an Aryl Esterase from Pseudomonas fluorescens Leads to Unique Peptide Flip and Increased Activity

PDB Compounds: (D:) Arylesterase

SCOPe Domain Sequences for d3t4ud_:

Sequence; same for both SEQRES and ATOM records:

>d3t4ud_ c.69.1.12 (D:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
stfvakdgtqiyfkdwgsgkpvlfshgwildadmweyqmeylssrgyrtiafdrrgfgrs
dqpwtgndydtfaddiaqliehldlkevtlvgfsmgggdvaryiarhgsarvaglvllga
vtplfgqkpdypqgvpldvfarfktellkdraqfisdfnapfyginkgqvvsqgvqtqtl
qiallaslkatvdcvtafaetdfrpdmakidvptlvihgdgdqivpfettgkvaaelikg
aelkvykdaphgfavthaqqlnedllaflkr

Timeline for d3t4ud_:

• d3t4ud_ is new in SCOPe 2.03-stable
  
• d3t4ud_ appears in SCOPe 2.04
  
• d3t4ud_ appears in the current release, SCOPe 2.08