Lineage for d3t4eb1 (3t4e B:4-106)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890629Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2890630Protein automated matches [226864] (40 species)
    not a true protein
  7. 2890830Species Salmonella enterica [TaxId:90371] [226189] (1 PDB entry)
  8. 2890832Domain d3t4eb1: 3t4e B:4-106 [216678]
    Other proteins in same PDB: d3t4ea2, d3t4eb2
    automated match to d1npda2
    complexed with nad, po4

Details for d3t4eb1

PDB Entry: 3t4e (more details), 1.95 Å

PDB Description: 1.95 angstrom crystal structure of shikimate 5-dehydrogenase (aroe) from salmonella enterica subsp. enterica serovar typhimurium in complex with nad
PDB Compounds: (B:) Quinate/shikimate dehydrogenase

SCOPe Domain Sequences for d3t4eb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t4eb1 c.58.1.0 (B:4-106) automated matches {Salmonella enterica [TaxId: 90371]}
takyeliglmaypirhslspemqnkalekaglpytymafevdnttfasaieglkalkmrg
tgvsmpnkqlaceyvdeltpaaklvgaintivnddgylrgynt

SCOPe Domain Coordinates for d3t4eb1:

Click to download the PDB-style file with coordinates for d3t4eb1.
(The format of our PDB-style files is described here.)

Timeline for d3t4eb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3t4eb2