![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
![]() | Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
![]() | Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
![]() | Protein automated matches [226864] (40 species) not a true protein |
![]() | Species Salmonella enterica [TaxId:90371] [226189] (1 PDB entry) |
![]() | Domain d3t4eb1: 3t4e B:4-106 [216678] Other proteins in same PDB: d3t4ea2, d3t4eb2 automated match to d1npda2 complexed with nad, po4 |
PDB Entry: 3t4e (more details), 1.95 Å
SCOPe Domain Sequences for d3t4eb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t4eb1 c.58.1.0 (B:4-106) automated matches {Salmonella enterica [TaxId: 90371]} takyeliglmaypirhslspemqnkalekaglpytymafevdnttfasaieglkalkmrg tgvsmpnkqlaceyvdeltpaaklvgaintivnddgylrgynt
Timeline for d3t4eb1: