Lineage for d3t4ea2 (3t4e A:107-288)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845190Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2845468Protein automated matches [227005] (6 species)
    not a true protein
  7. 2845541Species Salmonella enterica [TaxId:90371] [226190] (1 PDB entry)
  8. 2845542Domain d3t4ea2: 3t4e A:107-288 [216677]
    Other proteins in same PDB: d3t4ea1, d3t4eb1
    automated match to d1vi2b1
    complexed with nad, po4

Details for d3t4ea2

PDB Entry: 3t4e (more details), 1.95 Å

PDB Description: 1.95 angstrom crystal structure of shikimate 5-dehydrogenase (aroe) from salmonella enterica subsp. enterica serovar typhimurium in complex with nad
PDB Compounds: (A:) Quinate/shikimate dehydrogenase

SCOPe Domain Sequences for d3t4ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t4ea2 c.2.1.7 (A:107-288) automated matches {Salmonella enterica [TaxId: 90371]}
dgtghiraikesgfdmrgktmvllgaggaataigaqaaiegikeiklfnrkddffekava
fakrvnentdcvvtvtdladqhaftealasadiltngtkvgmkplenesligdvsllrpe
llvtecvynphmtkllqqaqqagcktidgygmllwqgaeqfelwtgkafpldyvkqvmgf
ta

SCOPe Domain Coordinates for d3t4ea2:

Click to download the PDB-style file with coordinates for d3t4ea2.
(The format of our PDB-style files is described here.)

Timeline for d3t4ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3t4ea1