SCOPe 2.08: Domain d3t4ea2: 3t4e A:107-288

Lineage for d3t4ea2 (3t4e A:107-288)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein automated matches [227005] (6 species)
   not a true protein

7. Species Salmonella enterica [TaxId:90371] [226190] (1 PDB entry)

8. Domain d3t4ea2: 3t4e A:107-288 [216677]
   Other proteins in same PDB: d3t4ea1, d3t4eb1
   automated match to d1vi2b1
   complexed with nad, po4

Details for d3t4ea2

PDB Entry: 3t4e, 1.95 Å

PDB Description: 1.95 angstrom crystal structure of shikimate 5-dehydrogenase (aroe) from salmonella enterica subsp. enterica serovar typhimurium in complex with nad

PDB Compounds: (A:) Quinate/shikimate dehydrogenase

SCOPe Domain Sequences for d3t4ea2:

Sequence; same for both SEQRES and ATOM records:

>d3t4ea2 c.2.1.7 (A:107-288) automated matches {Salmonella enterica [TaxId: 90371]}
dgtghiraikesgfdmrgktmvllgaggaataigaqaaiegikeiklfnrkddffekava
fakrvnentdcvvtvtdladqhaftealasadiltngtkvgmkplenesligdvsllrpe
llvtecvynphmtkllqqaqqagcktidgygmllwqgaeqfelwtgkafpldyvkqvmgf
ta

Timeline for d3t4ea2:

• d3t4ea2 first appeared in SCOPe 2.03
  
• d3t4ea2 appears in SCOPe 2.07