SCOPe 2.03: Domain d3t3ya_: 3t3y A:

Lineage for d3t3ya_ (3t3y A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (14 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.10: AlkB-like [141628] (3 proteins)
   automatically mapped to Pfam PF13532

6. Protein automated matches [191077] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [195877] (4 PDB entries)

8. Domain d3t3ya_: 3t3y A: [216675]
   automated match to d3t4hb_
   complexed with fe, md6

Details for d3t3ya_

PDB Entry: 3t3y, 2 Å

PDB Description: crystal structure of alkb in complex with fe(iii) and 2-(3- hydroxypicolinomido)acetic acid

PDB Compounds: (A:) Alpha-ketoglutarate-dependent dioxygenase AlkB

SCOPe Domain Sequences for d3t3ya_:

Sequence; same for both SEQRES and ATOM records:

>d3t3ya_ b.82.2.10 (A:) automated matches {Escherichia coli [TaxId: 83333]}
aagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthrqg
ylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqdkd
epdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplkag
fhpltidcrynltfrqagk

Timeline for d3t3ya_:

• d3t3ya_ is new in SCOPe 2.03-stable
  
• d3t3ya_ appears in SCOPe 2.04
  
• d3t3ya_ appears in the current release, SCOPe 2.08