![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [196470] (52 PDB entries) |
![]() | Domain d3t3rc_: 3t3r C: [216673] Other proteins in same PDB: d3t3rd2 automated match to d1dt6a_ complexed with 9pl, hem |
PDB Entry: 3t3r (more details), 2.4 Å
SCOPe Domain Sequences for d3t3rc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t3rc_ a.104.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} klppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavreal vdqaeefsgrgeqatfdwvfkgygvvfsngerakqlrrfsiatlrdfgvgkrgieeriqe eagflidalrgtgganidptfflsrtvsnvissivfgdrfdykdkeflsllrmmlgifqf tststgqlyemfssvmkhlpgpqqqafqllqgledfiakkvehnqrtldpnsprdfidsf lirmqeeeknpntefylknlvmttlnlfiggtetvsttlrygflllmkhpeveakvheei drvigknrqpkfedrakmpymeaviheiqrfgdvipmslarrvkkdtkfrdfflpkgtev ypmlgsvlrdpsffsnpqdfnpqhflnekgqfkksdafvpfsigkrncfgeglarmelfl ffttvmqnfrlkssqspkdidvspkhvgfatiprnytmsflpr
Timeline for d3t3rc_:
![]() Domains from other chains: (mouse over for more information) d3t3ra_, d3t3rb_, d3t3rd1, d3t3rd2 |