Lineage for d1wioa3 (1wio A:98-178)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9355Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 9365Protein CD4 [49149] (2 species)
  7. 9366Species Human (Homo sapiens) [TaxId:9606] [49150] (12 PDB entries)
  8. 9376Domain d1wioa3: 1wio A:98-178 [21667]
    Other proteins in same PDB: d1wioa1, d1wioa2, d1wiob1, d1wiob2

Details for d1wioa3

PDB Entry: 1wio (more details), 3.9 Å

PDB Description: structure of t-cell surface glycoprotein cd4, tetragonal crystal form
PDB Compounds: (A:)

SCOP Domain Sequences for d1wioa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wioa3 b.1.1.3 (A:98-178) CD4 {Human (Homo sapiens)}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

SCOP Domain Coordinates for d1wioa3:

Click to download the PDB-style file with coordinates for d1wioa3.
(The format of our PDB-style files is described here.)

Timeline for d1wioa3: