Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
Domain d3t3mf2: 3t3m F:108-214 [216664] Other proteins in same PDB: d3t3ma_, d3t3mc_, d3t3me_, d3t3mf1, d3t3mh_, d3t3ml1 automated match to d1dqdl2 complexed with ca, cl, nag, rc2, so4 |
PDB Entry: 3t3m (more details), 2.6 Å
SCOPe Domain Sequences for d3t3mf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t3mf2 b.1.1.2 (F:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d3t3mf2: