SCOPe 2.06: Domain d1cdia2: 1cdi A:98-178

Lineage for d1cdia2 (1cdi A:98-178)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein CD4 C2-set domains [49149] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49150] (31 PDB entries)

8. Domain d1cdia2: 1cdi A:98-178 [21666]
   Other proteins in same PDB: d1cdia1
   domain 2

Details for d1cdia2

PDB Entry: 1cdi, 2.9 Å

PDB Description: structures of an hiv and mhc binding fragment from human cd4 as refined in two crystal lattices

PDB Compounds: (A:) t cell surface glycoprotein cd4

SCOPe Domain Sequences for d1cdia2:

Sequence; same for both SEQRES and ATOM records:

>d1cdia2 b.1.1.3 (A:98-178) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

Timeline for d1cdia2:

• d1cdia2 first appeared (with stable ids) in SCOP 1.55, called d1cdi_2
  
• d1cdia2 appears in SCOPe 2.05
  
• d1cdia2 appears in SCOPe 2.07
  
• d1cdia2 appears in the current release, SCOPe 2.08