Lineage for d1cdia2 (1cdi A:98-178)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1109273Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 1109283Protein CD4 C2-set domains [49149] (2 species)
  7. 1109284Species Human (Homo sapiens) [TaxId:9606] [49150] (26 PDB entries)
  8. 1109306Domain d1cdia2: 1cdi A:98-178 [21666]
    Other proteins in same PDB: d1cdia1
    domain 2

Details for d1cdia2

PDB Entry: 1cdi (more details), 2.9 Å

PDB Description: structures of an hiv and mhc binding fragment from human cd4 as refined in two crystal lattices
PDB Compounds: (A:) t cell surface glycoprotein cd4

SCOPe Domain Sequences for d1cdia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cdia2 b.1.1.3 (A:98-178) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

SCOPe Domain Coordinates for d1cdia2:

Click to download the PDB-style file with coordinates for d1cdia2.
(The format of our PDB-style files is described here.)

Timeline for d1cdia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cdia1