Lineage for d1cdi_2 (1cdi 98-178)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 550420Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 550430Protein CD4 C2-set domains [49149] (2 species)
  7. 550431Species Human (Homo sapiens) [TaxId:9606] [49150] (15 PDB entries)
  8. 550442Domain d1cdi_2: 1cdi 98-178 [21666]
    Other proteins in same PDB: d1cdi_1
    domain 2

Details for d1cdi_2

PDB Entry: 1cdi (more details), 2.9 Å

PDB Description: structures of an hiv and mhc binding fragment from human cd4 as refined in two crystal lattices

SCOP Domain Sequences for d1cdi_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cdi_2 b.1.1.3 (98-178) CD4 C2-set domains {Human (Homo sapiens)}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

SCOP Domain Coordinates for d1cdi_2:

Click to download the PDB-style file with coordinates for d1cdi_2.
(The format of our PDB-style files is described here.)

Timeline for d1cdi_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cdi_1