SCOP 1.71: Domain d1cdi_2: 1cdi 98-178

Lineage for d1cdi_2 (1cdi 98-178)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.3: C2 set domains [49142] (7 proteins)

6. Protein CD4 C2-set domains [49149] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49150] (15 PDB entries)

8. Domain d1cdi_2: 1cdi 98-178 [21666]
   Other proteins in same PDB: d1cdi_1
   domain 2

Details for d1cdi_2

PDB Entry: 1cdi, 2.9 Å

PDB Description: structures of an hiv and mhc binding fragment from human cd4 as refined in two crystal lattices

SCOP Domain Sequences for d1cdi_2:

Sequence; same for both SEQRES and ATOM records:

>d1cdi_2 b.1.1.3 (98-178) CD4 C2-set domains {Human (Homo sapiens)}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

Timeline for d1cdi_2:

• d1cdi_2 first appeared (with stable ids) in SCOP 1.55
  
• d1cdi_2 appears in SCOP 1.69
  
• d1cdi_2 is called d1cdia2 in SCOP 1.73
  
• d1cdi_2 appears in the current release, SCOPe 2.08, called d1cdia2