SCOPe 2.03: Domain d3t3fa1: 3t3f A:293-422

Lineage for d3t3fa1 (3t3f A:293-422)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
   part of Klenow fragment, KF

7. Species Thermus aquaticus [TaxId:271] [53121] (24 PDB entries)

8. Domain d3t3fa1: 3t3f A:293-422 [216656]
   Other proteins in same PDB: d3t3fa2
   automated match to d1jxea1
   protein/DNA complex; complexed with fmt, gol, mg, n5p, na

Details for d3t3fa1

PDB Entry: 3t3f, 1.9 Å

PDB Description: Ternary Structure of the large fragment of Taq DNA polymerase bound to an abasic site and dNITP

PDB Compounds: (A:) DNA polymerase I, thermostable

SCOPe Domain Sequences for d3t3fa1:

Sequence; same for both SEQRES and ATOM records:

>d3t3fa1 c.55.3.5 (A:293-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus [TaxId: 271]}
aleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeargll
akdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserl
fanlwgrleg

Timeline for d3t3fa1:

• d3t3fa1 is new in SCOPe 2.03-stable
  
• d3t3fa1 appears in SCOPe 2.04
  
• d3t3fa1 appears in the current release, SCOPe 2.08