Lineage for d3t2wa_ (3t2w A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2073248Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2073249Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2073773Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 2073774Protein automated matches [190537] (8 species)
    not a true protein
  7. 2073811Species Shewanella denitrificans [TaxId:318161] [195517] (5 PDB entries)
  8. 2073836Domain d3t2wa_: 3t2w A: [216654]
    automated match to d3t2xc_
    complexed with btn

Details for d3t2wa_

PDB Entry: 3t2w (more details), 1.5 Å

PDB Description: crystal structure of shwanavidin (f43a) - biotin complex
PDB Compounds: (A:) Avidin/streptavidin

SCOPe Domain Sequences for d3t2wa_:

Sequence, based on SEQRES records: (download)

>d3t2wa_ b.61.1.0 (A:) automated matches {Shewanella denitrificans [TaxId: 318161]}
aqeltamsawvnqdgstlyinsinaqgeltgsyinraagaacqnspypvngwvfgtaisf
stkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt

Sequence, based on observed residues (ATOM records): (download)

>d3t2wa_ b.61.1.0 (A:) automated matches {Shewanella denitrificans [TaxId: 318161]}
aqeltamsawvnqdgstlyinsinaqgeltgsyinraagaacqnspypvngwvfgtaisf
stkwlnsvescnsitswsgfyingqgkistlwqlvvngssspsqilkgqdvfsqt

SCOPe Domain Coordinates for d3t2wa_:

Click to download the PDB-style file with coordinates for d3t2wa_.
(The format of our PDB-style files is described here.)

Timeline for d3t2wa_: