| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein automated matches [226848] (11 species) not a true protein |
| Species Wuchereria bancrofti [TaxId:6293] [226430] (1 PDB entry) |
| Domain d3t2ub2: 3t2u B:78-208 [216653] Other proteins in same PDB: d3t2ua1, d3t2ub1 automated match to d1tu7a1 complexed with gsh |
PDB Entry: 3t2u (more details), 2.3 Å
SCOPe Domain Sequences for d3t2ub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t2ub2 a.45.1.1 (B:78-208) automated matches {Wuchereria bancrofti [TaxId: 6293]}
ggneletthidmfcegvrdlhtkytkmiyqaydtekdsyikdilpvelakfekllatrdd
gknfilgekisyvdfvlfeeldihqildphcldkfpllkayhqrmedrpglkeyckqrnr
akipvngngkq
Timeline for d3t2ub2: