Lineage for d3t22c_ (3t22 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (138 species)
    not a true protein
  7. 2146100Species Porphyromonas gingivalis [TaxId:837] [225908] (2 PDB entries)
  8. 2146105Domain d3t22c_: 3t22 C: [216644]
    automated match to d1i69a_
    mutant

Details for d3t22c_

PDB Entry: 3t22 (more details), 2.2 Å

PDB Description: Crystal structure of OxyR mutant from Porphyromonas gingivalis
PDB Compounds: (C:) Redox-sensitive transcriptional activator OxyR

SCOPe Domain Sequences for d3t22c_:

Sequence, based on SEQRES records: (download)

>d3t22c_ c.94.1.0 (C:) automated matches {Porphyromonas gingivalis [TaxId: 837]}
grlniavlptiapyllprvfpiwkkelagleihvsemqtsrclasllsgeidmaiiaska
etegleddllyyeeflgyvsrceplfeqdvirttevnphrlwlldeghsfrdqlvrfcqm
kglherqtaysggsmeafmrlvesgqgitfipqltveqlspsqkelvrpfgmprpvrevr
lavrqdysrrklreqligllrsavpsdmhklqtgqhla

Sequence, based on observed residues (ATOM records): (download)

>d3t22c_ c.94.1.0 (C:) automated matches {Porphyromonas gingivalis [TaxId: 837]}
grlniavlptiapyllprvfpiwkkelagleihvsemqtsrclasllsgeidmaiiaska
etegleddllyyeeflgyvsrceplfeqdvirttevnphrlwlldeghsfrdqlvrfcqm
kgltaysggsmeafmrlvesgqgitfipqltveqlspsqkelvrpfgmprpvrevrlavr
qdysrrklreqligllrsavpsdmhklqtgqhla

SCOPe Domain Coordinates for d3t22c_:

Click to download the PDB-style file with coordinates for d3t22c_.
(The format of our PDB-style files is described here.)

Timeline for d3t22c_: