SCOPe 2.08: Domain d3t22c_: 3t22 C:

Lineage for d3t22c_ (3t22 C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Porphyromonas gingivalis [TaxId:837] [225908] (2 PDB entries)

8. Domain d3t22c_: 3t22 C: [216644]
   automated match to d1i69a_
   mutant

Details for d3t22c_

PDB Entry: 3t22, 2.2 Å

PDB Description: Crystal structure of OxyR mutant from Porphyromonas gingivalis

PDB Compounds: (C:) Redox-sensitive transcriptional activator OxyR

SCOPe Domain Sequences for d3t22c_:

Sequence, based on SEQRES records:

>d3t22c_ c.94.1.0 (C:) automated matches {Porphyromonas gingivalis [TaxId: 837]}
grlniavlptiapyllprvfpiwkkelagleihvsemqtsrclasllsgeidmaiiaska
etegleddllyyeeflgyvsrceplfeqdvirttevnphrlwlldeghsfrdqlvrfcqm
kglherqtaysggsmeafmrlvesgqgitfipqltveqlspsqkelvrpfgmprpvrevr
lavrqdysrrklreqligllrsavpsdmhklqtgqhla

Sequence, based on observed residues (ATOM records):

>d3t22c_ c.94.1.0 (C:) automated matches {Porphyromonas gingivalis [TaxId: 837]}
grlniavlptiapyllprvfpiwkkelagleihvsemqtsrclasllsgeidmaiiaska
etegleddllyyeeflgyvsrceplfeqdvirttevnphrlwlldeghsfrdqlvrfcqm
kgltaysggsmeafmrlvesgqgitfipqltveqlspsqkelvrpfgmprpvrevrlavr
qdysrrklreqligllrsavpsdmhklqtgqhla

Timeline for d3t22c_:

• d3t22c_ first appeared in SCOPe 2.03
  
• d3t22c_ appears in SCOPe 2.07