![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
![]() | Protein automated matches [190039] (161 species) not a true protein |
![]() | Species Porphyromonas gingivalis [TaxId:837] [225908] (2 PDB entries) |
![]() | Domain d3t22b_: 3t22 B: [216643] automated match to d1i69a_ mutant |
PDB Entry: 3t22 (more details), 2.2 Å
SCOPe Domain Sequences for d3t22b_:
Sequence, based on SEQRES records: (download)
>d3t22b_ c.94.1.0 (B:) automated matches {Porphyromonas gingivalis [TaxId: 837]} grlniavlptiapyllprvfpiwkkelagleihvsemqtsrclasllsgeidmaiiaska etegleddllyyeeflgyvsrceplfeqdvirttevnphrlwlldeghsfrdqlvrfcqm kglherqtaysggsmeafmrlvesgqgitfipqltveqlspsqkelvrpfgmprpvrevr lavrqdysrrklreqligllrsavpsdmhklqtgqhl
>d3t22b_ c.94.1.0 (B:) automated matches {Porphyromonas gingivalis [TaxId: 837]} grlniavlptiapyllprvfpiwkkelagleihvsemqtsrclasllsgeidmaiiaska etegleddllyyeeflgyvsrceplfeqdvirttevnphrlwlldeghsfrdqlvrfcay sggsmeafmrlvesgqgitfipqltveqlspsqkelvrpfgmprpvrevrlavrqdysrr klreqligllrsavpsdmhklqtgqhl
Timeline for d3t22b_: