Lineage for d3t1db_ (3t1d B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2413761Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2413962Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)
  7. 2413963Species Human (Homo sapiens) [TaxId:9606] [50836] (50 PDB entries)
  8. 2414043Domain d3t1db_: 3t1d B: [216640]
    automated match to d4iawa_
    complexed with cl, dbh, dbs, gol, td1, unx; mutant

Details for d3t1db_

PDB Entry: 3t1d (more details), 2.3 Å

PDB Description: the mutant structure of human siderocalin w79a, r81a, y106f bound to enterobactin
PDB Compounds: (B:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d3t1db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t1db_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy
nvtsvlfrkkkcdyaiatfvpgsqpgeftlgniksypgltsflvrvvstnynqhamvffk
kvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg

SCOPe Domain Coordinates for d3t1db_:

Click to download the PDB-style file with coordinates for d3t1db_.
(The format of our PDB-style files is described here.)

Timeline for d3t1db_: