SCOPe 2.05: Domain d3t1da_: 3t1d A:

Lineage for d3t1da_ (3t1d A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (34 PDB entries)

8. Domain d3t1da_: 3t1d A: [216639]
   automated match to d4iawa_
   complexed with cl, dbh, dbs, gol, td1, unx; mutant

Details for d3t1da_

PDB Entry: 3t1d, 2.3 Å

PDB Description: the mutant structure of human siderocalin w79a, r81a, y106f bound to enterobactin

PDB Compounds: (A:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d3t1da_:

Sequence; same for both SEQRES and ATOM records:

>d3t1da_ b.60.1.1 (A:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
stsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedk
synvtsvlfrkkkcdyaiatfvpgsqpgeftlgniksypgltsflvrvvstnynqhamvf
fkkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

Timeline for d3t1da_:

• d3t1da_ first appeared in SCOPe 2.03
  
• d3t1da_ appears in SCOPe 2.04
  
• d3t1da_ appears in SCOPe 2.06
  
• d3t1da_ appears in the current release, SCOPe 2.08