Lineage for d3t19a2 (3t19 A:430-557)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887284Species Hiv-1 m:b_hxb2r [TaxId:11706] [225268] (21 PDB entries)
  8. 2887291Domain d3t19a2: 3t19 A:430-557 [216636]
    Other proteins in same PDB: d3t19a1, d3t19a3, d3t19b_
    automated match to d1bqna1
    complexed with 5ma

Details for d3t19a2

PDB Entry: 3t19 (more details), 2.6 Å

PDB Description: Crystal structure of HIV-1 reverse transcriptase (wild type) in complex with inhibitor M05
PDB Compounds: (A:) reverse transcriptase

SCOPe Domain Sequences for d3t19a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t19a2 c.55.3.0 (A:430-557) automated matches {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagir

SCOPe Domain Coordinates for d3t19a2:

Click to download the PDB-style file with coordinates for d3t19a2.
(The format of our PDB-style files is described here.)

Timeline for d3t19a2:

View in 3D
Domains from other chains:
(mouse over for more information)
d3t19b_