SCOPe 2.08: Domain d3t19a2: 3t19 A:430-557

Lineage for d3t19a2 (3t19 A:430-557)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Hiv-1 m:b_hxb2r [TaxId:11706] [225268] (21 PDB entries)

8. Domain d3t19a2: 3t19 A:430-557 [216636]
   Other proteins in same PDB: d3t19a1, d3t19a3, d3t19b_
   automated match to d1bqna1
   complexed with 5ma

Details for d3t19a2

PDB Entry: 3t19, 2.6 Å

PDB Description: Crystal structure of HIV-1 reverse transcriptase (wild type) in complex with inhibitor M05

PDB Compounds: (A:) reverse transcriptase

SCOPe Domain Sequences for d3t19a2:

Sequence; same for both SEQRES and ATOM records:

>d3t19a2 c.55.3.0 (A:430-557) automated matches {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagir

Timeline for d3t19a2:

• d3t19a2 first appeared in SCOPe 2.03
  
• d3t19a2 appears in SCOPe 2.07