SCOPe 2.08: Domain d3t0xa_: 3t0x A:

Lineage for d3t0xa_ (3t0x A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3t0xa_: 3t0x A: [216631]
   automated match to d2e7lc_
   complexed with diw, edo, so4

Details for d3t0xa_

PDB Entry: 3t0x, 1.96 Å

PDB Description: fluorogen activating protein m8vla4(s55p) in complex with dimethylindole red

PDB Compounds: (A:) Immunoglobulin variable lambda domain M8VLA4(S55P)

SCOPe Domain Sequences for d3t0xa_:

Sequence; same for both SEQRES and ATOM records:

>d3t0xa_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epvltqspsvsgtpgqkvtifcsgsssnvednsvywyqqfpgttpkvliynddrrpsgvp
drfsgsksgtsaslaisglrsedeadyyclswddslngwvfgggtkvtvld

Timeline for d3t0xa_:

• d3t0xa_ first appeared in SCOPe 2.03
  
• d3t0xa_ appears in SCOPe 2.07