SCOP 1.75: Domain d1gc1c2: 1gc1 C:98-181

Lineage for d1gc1c2 (1gc1 C:98-181)

Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.3: C2 set domains [49142] (8 proteins)
Protein CD4 C2-set domains [49149] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [49150] (26 PDB entries)
Domain d1gc1c2: 1gc1 C:98-181 [21663]
Other proteins in same PDB: d1gc1c1, d1gc1g_, d1gc1h1, d1gc1h2, d1gc1l1, d1gc1l2
domain 2
complexed with fuc, nag; mutant

Details for d1gc1c2

PDB Entry: 1gc1 (more details), 2.5 Å

PDB Description: hiv-1 gp120 core complexed with cd4 and a neutralizing human antibody

PDB Compounds: (C:) cd4

SCOP Domain Sequences for d1gc1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gc1c2 b.1.1.3 (C:98-181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvlafqk

SCOP Domain Coordinates for d1gc1c2:

Click to download the PDB-style file with coordinates for d1gc1c2.
(The format of our PDB-style files is described here.)

Timeline for d1gc1c2: