![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (7 proteins) |
![]() | Protein CD4 C2-set domains [49149] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49150] (15 PDB entries) |
![]() | Domain d1gc1c2: 1gc1 C:98-181 [21663] Other proteins in same PDB: d1gc1c1, d1gc1g_, d1gc1h1, d1gc1h2, d1gc1l1, d1gc1l2 domain 2 complexed with fuc, nag; mutant |
PDB Entry: 1gc1 (more details), 2.5 Å
SCOP Domain Sequences for d1gc1c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gc1c2 b.1.1.3 (C:98-181) CD4 C2-set domains {Human (Homo sapiens)} fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw tctvlqnqkkvefkidivvlafqk
Timeline for d1gc1c2: