Lineage for d1gc1c2 (1gc1 C:98-181)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9355Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 9365Protein CD4 [49149] (2 species)
  7. 9366Species Human (Homo sapiens) [TaxId:9606] [49150] (12 PDB entries)
  8. 9372Domain d1gc1c2: 1gc1 C:98-181 [21663]
    Other proteins in same PDB: d1gc1c1, d1gc1g_, d1gc1h1, d1gc1h2, d1gc1l1, d1gc1l2

Details for d1gc1c2

PDB Entry: 1gc1 (more details), 2.5 Å

PDB Description: hiv-1 gp120 core complexed with cd4 and a neutralizing human antibody

SCOP Domain Sequences for d1gc1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gc1c2 b.1.1.3 (C:98-181) CD4 {Human (Homo sapiens)}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvlafqk

SCOP Domain Coordinates for d1gc1c2:

Click to download the PDB-style file with coordinates for d1gc1c2.
(The format of our PDB-style files is described here.)

Timeline for d1gc1c2:

9372
d1gc1c2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1gc1c1