SCOPe 2.03: Domain d3szhd_: 3szh D:

Lineage for d3szhd_ (3szh D:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.0: automated matches [191402] (1 protein)
   not a true family

6. Protein automated matches [190537] (7 species)
   not a true protein

7. Species Shewanella denitrificans [TaxId:318161] [195517] (5 PDB entries)

8. Domain d3szhd_: 3szh D: [216618]
   automated match to d3szig_

Details for d3szhd_

PDB Entry: 3szh, 1.07 Å

PDB Description: Crystal structure of apo shwanavidin (P1 form)

PDB Compounds: (D:) Avidin/streptavidin

SCOPe Domain Sequences for d3szhd_:

Sequence, based on SEQRES records:

>d3szhd_ b.61.1.0 (D:) automated matches {Shewanella denitrificans [TaxId: 318161]}
maqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtais
fstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt

Sequence, based on observed residues (ATOM records):

>d3szhd_ b.61.1.0 (D:) automated matches {Shewanella denitrificans [TaxId: 318161]}
maqeltamsawvnqdgstlyinsinaqgeltgsyinraafacqnspypvngwvfgtaisf
stkwlnsvescnsitswsgfyintgqgkistlwqlvvngssspsqilkgqdvfsqt

Timeline for d3szhd_:

• d3szhd_ is new in SCOPe 2.03-stable
  
• d3szhd_ appears in SCOPe 2.04
  
• d3szhd_ appears in the current release, SCOPe 2.08