SCOPe 2.06: Domain d3szhc1: 3szh C:3-120

Lineage for d3szhc1 (3szh C:3-120)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.0: automated matches [191402] (1 protein)
   not a true family

6. Protein automated matches [190537] (8 species)
   not a true protein

7. Species Shewanella denitrificans [TaxId:318161] [195517] (5 PDB entries)

8. Domain d3szhc1: 3szh C:3-120 [216617]
   Other proteins in same PDB: d3szhc2
   automated match to d3szig_

Details for d3szhc1

PDB Entry: 3szh, 1.07 Å

PDB Description: Crystal structure of apo shwanavidin (P1 form)

PDB Compounds: (C:) Avidin/streptavidin

SCOPe Domain Sequences for d3szhc1:

Sequence, based on SEQRES records:

>d3szhc1 b.61.1.0 (C:3-120) automated matches {Shewanella denitrificans [TaxId: 318161]}
maqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtais
fstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt

Sequence, based on observed residues (ATOM records):

>d3szhc1 b.61.1.0 (C:3-120) automated matches {Shewanella denitrificans [TaxId: 318161]}
maqeltamsawvnqdgstlyinsinaqgeltgsyinraafacqnspypvngwvfgtaisf
stkwlnsvescnsitswsgfyintgqgkistlwqlvvngssspsqilkgqdvfsqt

Timeline for d3szhc1:

• d3szhc1 first appeared in SCOPe 2.03, called d3szhc_
  
• d3szhc1 was called d3szhc_ in SCOPe 2.05
  
• d3szhc1 appears in SCOPe 2.07
  
• d3szhc1 appears in the current release, SCOPe 2.08