SCOPe 2.07: Domain d3szhb_: 3szh B:

Lineage for d3szhb_ (3szh B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.0: automated matches [191402] (1 protein)
   not a true family

6. Protein automated matches [190537] (10 species)
   not a true protein

7. Species Shewanella denitrificans [TaxId:318161] [195517] (5 PDB entries)

8. Domain d3szhb_: 3szh B: [216616]
   Other proteins in same PDB: d3szhc2
   automated match to d3szig_

Details for d3szhb_

PDB Entry: 3szh, 1.07 Å

PDB Description: Crystal structure of apo shwanavidin (P1 form)

PDB Compounds: (B:) Avidin/streptavidin

SCOPe Domain Sequences for d3szhb_:

Sequence, based on SEQRES records:

>d3szhb_ b.61.1.0 (B:) automated matches {Shewanella denitrificans [TaxId: 318161]}
maqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtais
fstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt

Sequence, based on observed residues (ATOM records):

>d3szhb_ b.61.1.0 (B:) automated matches {Shewanella denitrificans [TaxId: 318161]}
maqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtais
fstkwlnsvescnsitswsgfyingqgkistlwqlvvngssspsqilkgqdvfsqt

Timeline for d3szhb_:

• d3szhb_ first appeared in SCOPe 2.03
  
• d3szhb_ appears in SCOPe 2.06
  
• d3szhb_ appears in the current release, SCOPe 2.08