Lineage for d3sz8c_ (3sz8 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086072Family c.1.10.4: Class I DAHP synthetase [51599] (3 protein domains)
  6. 2086269Protein automated matches [190083] (8 species)
    not a true protein
  7. 2086273Species Burkholderia pseudomallei [TaxId:320372] [189833] (3 PDB entries)
  8. 2086280Domain d3sz8c_: 3sz8 C: [216613]
    Other proteins in same PDB: d3sz8a2, d3sz8b2, d3sz8d2
    automated match to d3unda_
    complexed with act

Details for d3sz8c_

PDB Entry: 3sz8 (more details), 2.05 Å

PDB Description: Crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from Burkholderia pseudomallei
PDB Compounds: (C:) 2-dehydro-3-deoxyphosphooctonate aldolase 2

SCOPe Domain Sequences for d3sz8c_:

Sequence, based on SEQRES records: (download)

>d3sz8c_ c.1.10.4 (C:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasfdkan
rssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpaflarqt
dlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlvvdml
gfrqmaettggcpvifdvthslqcrdplgdasggrrrqvldlaragiavgiaglfleahp
dpdrarcdgpsalplhqlegllsqmkaiddlvkrmpale

Sequence, based on observed residues (ATOM records): (download)

>d3sz8c_ c.1.10.4 (C:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasfdkan
rssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpaflarqt
dlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlvvdml
gfrqmaettggcpvifdvthslqvldlaragiavgiaglfleahpdpdrarcdgpsalpl
hqlegllsqmkaiddlvkrmpale

SCOPe Domain Coordinates for d3sz8c_:

Click to download the PDB-style file with coordinates for d3sz8c_.
(The format of our PDB-style files is described here.)

Timeline for d3sz8c_: