Lineage for d1cdh_2 (1cdh 98-178)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104668Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 104678Protein CD4 [49149] (2 species)
  7. 104679Species Human (Homo sapiens) [TaxId:9606] [49150] (13 PDB entries)
  8. 104683Domain d1cdh_2: 1cdh 98-178 [21661]
    Other proteins in same PDB: d1cdh_1

Details for d1cdh_2

PDB Entry: 1cdh (more details), 2.3 Å

PDB Description: structures of an hiv and mhc binding fragment from human cd4 as refined in two crystal lattices

SCOP Domain Sequences for d1cdh_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cdh_2 b.1.1.3 (98-178) CD4 {Human (Homo sapiens)}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

SCOP Domain Coordinates for d1cdh_2:

Click to download the PDB-style file with coordinates for d1cdh_2.
(The format of our PDB-style files is described here.)

Timeline for d1cdh_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cdh_1