SCOPe 2.05: Domain d3sx4b1: 3sx4 B:40-508

Lineage for d3sx4b1 (3sx4 B:40-508)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)
   automatically mapped to Pfam PF00930

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
   Pfam PF00930

6. Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82174] (82 PDB entries)
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d3sx4b1: 3sx4 B:40-508 [216604]
   Other proteins in same PDB: d3sx4a2, d3sx4b2
   automated match to d1orva1
   complexed with kxa, nag

Details for d3sx4b1

PDB Entry: 3sx4, 2.6 Å

PDB Description: crystal structure of human dpp-iv in complex with sa-(+)-3- (aminomethyl)-4-(2,4-dichlorophenyl)-6-(2-methoxyphenyl)- 2-methyl- 5h-pyrrolo[3,4-b]pyridin-7(6h)-one

PDB Compounds: (B:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d3sx4b1:

Sequence; same for both SEQRES and ATOM records:

>d3sx4b1 b.70.3.1 (B:40-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

Timeline for d3sx4b1:

• d3sx4b1 first appeared in SCOPe 2.03
  
• d3sx4b1 appears in SCOPe 2.04
  
• d3sx4b1 appears in SCOPe 2.06
  
• d3sx4b1 appears in the current release, SCOPe 2.08