![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (7 proteins) |
![]() | Protein CD4 [49149] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49150] (13 PDB entries) |
![]() | Domain d1g9mc2: 1g9m C:98-181 [21660] Other proteins in same PDB: d1g9mc1, d1g9mg_, d1g9mh1, d1g9mh2, d1g9ml1, d1g9ml2 complexed with fuc, ioh, nag; mutant |
PDB Entry: 1g9m (more details), 2.2 Å
SCOP Domain Sequences for d1g9mc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g9mc2 b.1.1.3 (C:98-181) CD4 {Human (Homo sapiens)} fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw tctvlqnqkkvefkidivvlafqk
Timeline for d1g9mc2: