Lineage for d1g9mc2 (1g9m C:98-181)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9355Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 9365Protein CD4 [49149] (2 species)
  7. 9366Species Human (Homo sapiens) [TaxId:9606] [49150] (12 PDB entries)
  8. 9369Domain d1g9mc2: 1g9m C:98-181 [21660]
    Other proteins in same PDB: d1g9mc1, d1g9mg_, d1g9mh1, d1g9mh2, d1g9ml1, d1g9ml2

Details for d1g9mc2

PDB Entry: 1g9m (more details), 2.2 Å

PDB Description: hiv-1 hxbc2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

SCOP Domain Sequences for d1g9mc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9mc2 b.1.1.3 (C:98-181) CD4 {Human (Homo sapiens)}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvlafqk

SCOP Domain Coordinates for d1g9mc2:

Click to download the PDB-style file with coordinates for d1g9mc2.
(The format of our PDB-style files is described here.)

Timeline for d1g9mc2: