SCOPe 2.03: Domain d3swod1: 3swo D:11-243

Lineage for d3swod1 (3swo D:11-243)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (14 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [226167] (3 PDB entries)

8. Domain d3swod1: 3swo D:11-243 [216594]
   Other proteins in same PDB: d3swoa2, d3swob2, d3swoc2, d3swod2
   automated match to d1siqa2
   complexed with edo, fda, unx

Details for d3swod1

PDB Entry: 3swo, 1.45 Å

PDB Description: crystal structure of a glutaryl-coa dehydrogenase from mycobacterium smegmatis in complex with fadh2

PDB Compounds: (D:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3swod1:

Sequence; same for both SEQRES and ATOM records:

>d3swod1 e.6.1.0 (D:11-243) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
tyaplelfdtdrlldqderdiaatvrqfvdtrlkpnvegwfesatlpselakefgnlgvl
gmhlqgygcagtnavsyglacmeleagdsgfrsfvsvqgslsmfsiyrygseeqknewlp
rlaagdaigcfgltepdfgsnpagmrtrarrdgsdwilngtkmwitngnladvatvwaqt
ddgirgflvptdtpgftaneihrklslrasvtselvldnvrlpasaqlplaeg

Timeline for d3swod1:

• d3swod1 is new in SCOPe 2.03-stable
  
• d3swod1 appears in SCOPe 2.04
  
• d3swod1 appears in the current release, SCOPe 2.08