| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
| Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
| Protein automated matches [226935] (15 species) not a true protein |
| Species Mycobacterium smegmatis [TaxId:246196] [226168] (3 PDB entries) |
| Domain d3swob2: 3swo B:244-396 [216591] Other proteins in same PDB: d3swoa1, d3swob1, d3swoc1, d3swod1 automated match to d1siqa1 complexed with edo, fda, unx |
PDB Entry: 3swo (more details), 1.45 Å
SCOPe Domain Sequences for d3swob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3swob2 a.29.3.0 (B:244-396) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
lsaplsclnearfgivfgalgaardslettiaytqsrevfdkplsnyqltqeklanmtve
lgkgmllaihlgrikdaegvrpeqislgklnnvreaiaiarecrtllggsgitleysplr
hannlesvltyegtsemhllsigkaltgkaafr
Timeline for d3swob2: