| Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
| Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) ![]() flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
| Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
| Protein automated matches [226934] (14 species) not a true protein |
| Species Mycobacterium smegmatis [TaxId:246196] [226167] (3 PDB entries) |
| Domain d3swob1: 3swo B:11-243 [216590] Other proteins in same PDB: d3swoa2, d3swob2, d3swoc2, d3swod2 automated match to d1siqa2 complexed with edo, fda, unx |
PDB Entry: 3swo (more details), 1.45 Å
SCOPe Domain Sequences for d3swob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3swob1 e.6.1.0 (B:11-243) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
tyaplelfdtdrlldqderdiaatvrqfvdtrlkpnvegwfesatlpselakefgnlgvl
gmhlqgygcagtnavsyglacmeleagdsgfrsfvsvqgslsmfsiyrygseeqknewlp
rlaagdaigcfgltepdfgsnpagmrtrarrdgsdwilngtkmwitngnladvatvwaqt
ddgirgflvptdtpgftaneihrklslrasvtselvldnvrlpasaqlplaeg
Timeline for d3swob1: