Lineage for d3swoa1 (3swo A:9-243)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1451317Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1451318Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1451455Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 1451456Protein automated matches [226934] (14 species)
    not a true protein
  7. 1451525Species Mycobacterium smegmatis [TaxId:246196] [226167] (3 PDB entries)
  8. 1451526Domain d3swoa1: 3swo A:9-243 [216588]
    Other proteins in same PDB: d3swoa2, d3swob2, d3swoc2, d3swod2
    automated match to d1siqa2
    complexed with edo, fda, unx

Details for d3swoa1

PDB Entry: 3swo (more details), 1.45 Å

PDB Description: crystal structure of a glutaryl-coa dehydrogenase from mycobacterium smegmatis in complex with fadh2
PDB Compounds: (A:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3swoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3swoa1 e.6.1.0 (A:9-243) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
kstyaplelfdtdrlldqderdiaatvrqfvdtrlkpnvegwfesatlpselakefgnlg
vlgmhlqgygcagtnavsyglacmeleagdsgfrsfvsvqgslsmfsiyrygseeqknew
lprlaagdaigcfgltepdfgsnpagmrtrarrdgsdwilngtkmwitngnladvatvwa
qtddgirgflvptdtpgftaneihrklslrasvtselvldnvrlpasaqlplaeg

SCOPe Domain Coordinates for d3swoa1:

Click to download the PDB-style file with coordinates for d3swoa1.
(The format of our PDB-style files is described here.)

Timeline for d3swoa1: