Lineage for d3swla2 (3swl A:92-237)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713549Protein automated matches [226848] (14 species)
    not a true protein
  7. 2713569Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)
  8. 2713663Domain d3swla2: 3swl A:92-237 [216587]
    Other proteins in same PDB: d3swla1
    automated match to d1k0ma1
    mutant

Details for d3swla2

PDB Entry: 3swl (more details), 2.35 Å

PDB Description: Crystal Structure Analysis of H74A Mutant of Human CLIC1
PDB Compounds: (A:) chloride intracellular channel protein 1

SCOPe Domain Sequences for d3swla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3swla2 a.45.1.1 (A:92-237) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpee
vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhryls
nayareefastcpddeeielayeqva

SCOPe Domain Coordinates for d3swla2:

Click to download the PDB-style file with coordinates for d3swla2.
(The format of our PDB-style files is described here.)

Timeline for d3swla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3swla1