Lineage for d1cdya2 (1cdy A:98-178)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 786974Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 786984Protein CD4 C2-set domains [49149] (2 species)
  7. 786985Species Human (Homo sapiens) [TaxId:9606] [49150] (26 PDB entries)
  8. 786993Domain d1cdya2: 1cdy A:98-178 [21658]
    Other proteins in same PDB: d1cdya1
    domain 2
    mutant

Details for d1cdya2

PDB Entry: 1cdy (more details), 2 Å

PDB Description: structure of t-cell surface glycoprotein cd4 mutant with gly 47 replaced by ser
PDB Compounds: (A:) T-cell surface glycoprotein cd4

SCOP Domain Sequences for d1cdya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cdya2 b.1.1.3 (A:98-178) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

SCOP Domain Coordinates for d1cdya2:

Click to download the PDB-style file with coordinates for d1cdya2.
(The format of our PDB-style files is described here.)

Timeline for d1cdya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cdya1