Lineage for d1cdy_2 (1cdy 98-178)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 454592Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 454602Protein CD4 C2-set domains [49149] (2 species)
  7. 454603Species Human (Homo sapiens) [TaxId:9606] [49150] (15 PDB entries)
  8. 454604Domain d1cdy_2: 1cdy 98-178 [21658]
    Other proteins in same PDB: d1cdy_1
    domain 2

Details for d1cdy_2

PDB Entry: 1cdy (more details), 2 Å

PDB Description: structure of t-cell surface glycoprotein cd4 mutant with gly 47 replaced by ser
PDB Compounds: ( :)

SCOP Domain Sequences for d1cdy_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cdy_2 b.1.1.3 (98-178) CD4 C2-set domains {Human (Homo sapiens)}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

SCOP Domain Coordinates for d1cdy_2:

Click to download the PDB-style file with coordinates for d1cdy_2.
(The format of our PDB-style files is described here.)

Timeline for d1cdy_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cdy_1